PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s779741g003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GATA
Protein Properties Length: 240aa    MW: 26843.9 Da    PI: 8.8546
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s779741g003genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.48.6e-18168202135
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                        C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  PDK_30s779741g003 168 CTHCLSHKTPQWRAGPLGPKTLCNACGVRFKSGRL 202
                        *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.121162198IPR000679Zinc finger, GATA-type
SMARTSM004011.2E-15162216IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.2E-13166200IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577163.04E-14166226No hitNo description
CDDcd002021.89E-13167224No hitNo description
PROSITE patternPS003440168193IPR000679Zinc finger, GATA-type
PfamPF003201.5E-15168202IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MEIYCSLSLS LSLSLSLFVG YGFHKKFALQ HLLIEEFEGE EDVSLEWLSI YVEDCLSGTT  60
SYTSQPLPPP TTISHDTPPP KPPTKTSSFR DLAIPAKARS KRRRVTTPKE LTSQDPLLFH  120
QTCWLADSEL ILPKKEQEDK APAVELLVGG GGEAGEKMGK EQQQIRRCTH CLSHKTPQWR  180
AGPLGPKTLC NACGVRFKSG RLLPEYRPAK SPTFVSYKHS NSHKKVMEMR MMAILSSQSN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100104KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008812058.11e-150PREDICTED: GATA transcription factor 2-like
TrEMBLM0SQV21e-67M0SQV2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P21390_0014e-67(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.17e-40GATA transcription factor 2